SignalP The Igk signal peptide sequence plays a crucial role in the proper folding, targeting, and secretion of immunoglobulin kappa (Igk) light chains, which are essential components of antibodies. This short peptide, typically found at the N-terminus of nascent Igk proteins, acts as a molecular "zip code," directing the polypeptide chain to the endoplasmic reticulum (ER) for further processing and eventual release from the cell. Understanding its sequence and function is vital for researchers involved in protein expression, antibody engineering, and molecular biology.
Signal peptides, also known as leader sequences, are generally composed of three distinct regions: an N-terminal charged region, a central hydrophobic core, and a C-terminal region that is often cleaved by a signal peptidase.SignalP 6.0 - DTU Health Tech - Bioinformatic Services The specific amino acid sequence of the Igk signal peptide dictates its interaction with cellular machinery, ensuring that the Igk light chain is translocated across the ER membrane.IGK immunoglobulin kappa locus [Homo sapiens (human)] This translocation is a critical step for the assembly of functional antibodies, which are secreted proteins. The precise sequence varies between species, with notable examples including the murine (mouse) IgG kappa signal peptide and human IGK@ protein sequences, each optimized for their respective cellular environments.
The primary function of the Igk signal peptide sequence is to initiate the secretion pathway. As the Igk light chain is synthesized by ribosomes, the signal peptide emerges first, recognized by the signal recognition particle (SRP). This complex then targets the ribosome-mRNA-nascent polypeptide to the ER membrane, where the signal peptide facilitates the translocation of the growing polypeptide chain into the ER lumen. Within the ER, the signal peptide is typically cleaved off by a signal peptidase, leaving the mature Igk light chain free to fold correctly, undergo disulfide bond formation, and associate with immunoglobulin heavy chains to form a complete antibody.
Researchers often leverage the Igk signal peptide in various biotechnological applications. For instance, it can be incorporated into expression vectors to enhance the secretion of recombinant proteins, including therapeutic antibodies and antigens. Studies have shown that using specific Igk signal peptides, such as those derived from mouse IgG kappa, can significantly improve the yield and efficacy of secreted recombinant proteins. This is particularly relevant in mammalian cell expression systems, where efficient translocation into the secretory pathway is paramount for high-level protein production作者:X Wang·2016·被引用次数:18—The N-terminus sequence of the purified CYTL1 protein wasThr-Pro-Pro-Thr-Cys-Tyr-Ser, which matched the mature CYTL1 amino acid sequence (Fig.. The choice of signal peptide can influence secretion efficiency, and tools like SignalP are employed to predict and analyze signal peptide sequences, aiding in the optimization of protein expression constructs.
While the general function of signal peptides is conserved, variations in their sequences can lead to differences in efficiency and targeting. For example, the murine Igk signal peptide sequence has been studied extensively for its ability to promote secretion2022年9月11日—The Igκ secretionsignalis derived from the IgGκ light chain that originates from the Mus musculus (mouse).4Thissignalis apeptidethat .... The sequence "MSVLTQVLALLLLWLTGARCDIQMTQSPASLSASVGETVTITCRASGNIH" is an example of an Ig kappa chain V-V region sequence that includes a signal peptideIn this study, we evaluatedtwo signal peptide sequencesfor a model recombinant humanized IgG. Productivity was evaluated at the transient transfection and .... Similarly, human IGK@ protein sequences also feature distinct signal peptides.Identical with the Gene Bank Ref. IDsequence. Nucleotide may contain silent mutation without changing amino acidsequence. Cat: MG53734-ACR. 产品名称: Mouse, ...
The ability to manipulate and utilize these signal sequences has opened avenues for protein engineering.作者:A Pulkina·2023·被引用次数:18—We found that vectors carrying the IgGκsignal peptidesprovided better protection against RSV. Immunization with the IgGκ-containing vectors ... By understanding the critical features of the Igk signal peptide, scientists can design chimeric signal peptides or select the most effective natural signal peptides for specific protein targets.Search bySequenceperforms a nucleotide-nucleotide or protein-translated nucleotide BLAST search against Addgene's plasmidsequence... This optimization is crucial for the cost-effective production of biologics and for advancing research in areas like vaccine development, where efficient expression of viral antigens is key. For instance, incorporating an IgG kappa signal peptide has been shown to enhance the efficacy of certain vaccine constructs.The histidine affinity tag (HAT) tag is derived from chicken lactate dehydrogenase.Sequences. 6His version (most common) HHHHHH. 6x HisAsn. HNHNHNHNHNHN.
In summary, the Igk signal peptide sequence is a critical determinant of immunoglobulin kappa light chain secretion. Its well-defined role in initiating the secretory pathway, coupled with variations across species, makes it a valuable tool in protein expression and antibody engineering. Researchers continue to explore and optimize the use of these short peptides to improve the production of vital therapeutic proteins and advance biological researchSignalP 6.0 - DTU Health Tech - Bioinformatic Services.
Join the newsletter to receive news, updates, new products and freebies in your inbox.